Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Human (Homo sapiens), HLA-DQ group [TaxId:9606] [88630] (3 PDB entries) probably orthologous to the mouse I-A group |
Domain d1jk8b1: 1jk8 B:95-192 [63147] Other proteins in same PDB: d1jk8a1, d1jk8a2, d1jk8b2 complexed with a human insulin peptide complexed with nag |
PDB Entry: 1jk8 (more details), 2.4 Å
SCOPe Domain Sequences for d1jk8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jk8b1 b.1.1.2 (B:95-192) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} veptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwt fqilvmlemtpqrgdvytchvehpslqnpiivewraqs
Timeline for d1jk8b1: