Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) |
Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein) contains irregular N-terminal extension to the common fold |
Protein Ribosomal protein L32e [52044] (1 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (19 PDB entries) |
Domain d1jj2x_: 1jj2 X: [63109] Other proteins in same PDB: d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2y_, d1jj2z_ |
PDB Entry: 1jj2 (more details), 2.4 Å
SCOP Domain Sequences for d1jj2x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jj2x_ c.9.2.1 (X:) Ribosomal protein L32e {Archaeon Haloarcula marismortui} telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr erieeeaedagirvlnptyvev
Timeline for d1jj2x_:
View in 3D Domains from other chains: (mouse over for more information) d1jj21_, d1jj22_, d1jj2a1, d1jj2a2, d1jj2b_, d1jj2c_, d1jj2d_, d1jj2e1, d1jj2e2, d1jj2f_, d1jj2g_, d1jj2h_, d1jj2i_, d1jj2j_, d1jj2k_, d1jj2l_, d1jj2m_, d1jj2n_, d1jj2o_, d1jj2p_, d1jj2q_, d1jj2r_, d1jj2s_, d1jj2t_, d1jj2u_, d1jj2v_, d1jj2w_, d1jj2y_, d1jj2z_ |