SCOP 1.67: Domain d1jh0h1: 1jh0 H:36-248

Lineage for d1jh0h1 (1jh0 H:36-248)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (2 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (38 PDB entries)

8. Domain d1jh0h1: 1jh0 H:36-248 [63034]
   Other proteins in same PDB: d1jh0h2, d1jh0l_, d1jh0m_
   complexed with bcl, bph, fe, spo, u10; mutant

Details for d1jh0h1

PDB Entry: 1jh0, 3.5 Å

PDB Description: photosynthetic reaction center mutant with glu l 205 replaced to leu

SCOP Domain Sequences for d1jh0h1:

Sequence; same for both SEQRES and ATOM records:

>d1jh0h1 b.41.1.1 (H:36-248) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkr

Timeline for d1jh0h1:

• d1jh0h1 first appeared in SCOP 1.57
  
• d1jh0h1 appears in SCOP 1.65
  
• d1jh0h1 appears in SCOP 1.69
  
• d1jh0h1 appears in the current release, SCOPe 2.08