Class f: Membrane and cell surface proteins and peptides [56835] (42 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
Protein M (medium) subunit [81481] (3 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81479] (38 PDB entries) |
Domain d1jgzm_: 1jgz M: [63033] Other proteins in same PDB: d1jgzh1, d1jgzh2, d1jgzl_ complexed with bcl, bph, cdl, fe, spo, u10; mutant |
PDB Entry: 1jgz (more details), 2.7 Å
SCOP Domain Sequences for d1jgzm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jgzm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides} aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl fsglmwfftigiwfwkqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn hg
Timeline for d1jgzm_: