Lineage for d1jgpv_ (1jgp V:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3042558Protein 70S ribosome functional complex [58121] (4 species)
  7. 3043115Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 3043292Domain d1jgpv_: 1jgp V: [62994]

Details for d1jgpv_

PDB Entry: 1jgp (more details)

PDB Description: the path of messenger rna through the ribosome. this file, 1jgp, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy
PDB Compounds: (V:) 30S ribosomal protein S19

SCOPe Domain Sequences for d1jgpv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgpv_ i.1.1.1 (V:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOPe Domain Coordinates for d1jgpv_:

Click to download the PDB-style file with coordinates for d1jgpv_.
(The format of our PDB-style files is described here.)

Timeline for d1jgpv_: