Lineage for d1jgpf_ (1jgp F:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2647135Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2647136Protein 70S ribosome functional complex [58121] (4 species)
  7. 2647693Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 2647853Domain d1jgpf_: 1jgp F: [62978]

Details for d1jgpf_

PDB Entry: 1jgp (more details), 7 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgp, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy
PDB Compounds: (F:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1jgpf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgpf_ i.1.1.1 (F:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
idygfalarttygvlgvkayiflgev

SCOPe Domain Coordinates for d1jgpf_:

Click to download the PDB-style file with coordinates for d1jgpf_.
(The format of our PDB-style files is described here.)

Timeline for d1jgpf_: