Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein Tubulin alpha-subunit [55311] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [64321] (5 PDB entries) Uniprot P02550 |
Domain d1jffa2: 1jff A:246-439 [62933] Other proteins in same PDB: d1jffa1, d1jffb1, d1jffb2 complexed with gdp, gtp, mg, ta1, zn |
PDB Entry: 1jff (more details), 3.5 Å
SCOPe Domain Sequences for d1jffa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jffa2 d.79.2.1 (A:246-439) Tubulin alpha-subunit {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprghfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvds
Timeline for d1jffa2: