SCOP 1.63: Domain d1jcea1: 1jce A:4-140

Lineage for d1jcea1 (1jce A:4-140)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Prokaryotic actin homolog MreB [64087] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [64088] (3 PDB entries)

8. Domain d1jcea1: 1jce A:4-140 [62876]

Details for d1jcea1

PDB Entry: 1jce, 2.1 Å

PDB Description: mreb from thermotoga maritima

SCOP Domain Sequences for d1jcea1:

Sequence; same for both SEQRES and ATOM records:

>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima}
kdigidlgtantlvflrgkgivvnepsviaidsttgeilkvgleaknmigktpatikair
pmrdgviadytvalvmlryfinkakggmnlfkprvvigvpigitdverraildagleaga
skvflieepmaaaigsn

Timeline for d1jcea1:

• d1jcea1 first appeared in SCOP 1.57
  
• d1jcea1 appears in SCOP 1.61
  
• d1jcea1 appears in SCOP 1.65
  
• d1jcea1 appears in the current release, SCOPe 2.08