Class b: All beta proteins [48724] (144 folds) |
Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins) barrel, closed; n=5, S=10 |
Protein Telomere end binding protein alpha subunit [50273] (1 species) duplication: consists of three domains of this fold |
Species Oxytricha nova [TaxId:200597] [50274] (15 PDB entries) |
Domain d1jb7a2: 1jb7 A:205-328 [62837] Other proteins in same PDB: d1jb7b_ |
PDB Entry: 1jb7 (more details), 1.86 Å
SCOP Domain Sequences for d1jb7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jb7a2 b.40.4.3 (A:205-328) Telomere end binding protein alpha subunit {Oxytricha nova} vissdmytalnkaqaqkgdfdvvakilqvheldeytnelklkdasgqvfytlslklkfph vrtgevvrirsatydetstqkkvlilshysniitfiqssklakelrakiqddhsvevasl kknv
Timeline for d1jb7a2: