SCOP 1.63: Domain d1j6za2: 1j6z A:147-372

Lineage for d1j6za2 (1j6z A:147-372)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (10 PDB entries)

8. Domain d1j6za2: 1j6z A:147-372 [62668]
   complexed with adp, ca, rho

Details for d1j6za2

PDB Entry: 1j6z, 1.54 Å

PDB Description: uncomplexed actin

SCOP Domain Sequences for d1j6za2:

Sequence; same for both SEQRES and ATOM records:

>d1j6za2 c.55.1.1 (A:147-372) Actin {Rabbit (Oryctolagus cuniculus)}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhr

Timeline for d1j6za2:

• d1j6za2 first appeared in SCOP 1.57
  
• d1j6za2 appears in SCOP 1.61
  
• d1j6za2 appears in SCOP 1.65
  
• d1j6za2 appears in the current release, SCOPe 2.08