![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) ![]() |
![]() | Family c.37.1.13: Extended AAA-ATPase domain [52700] (16 proteins) |
![]() | Protein Replication factor C [64035] (1 species) |
![]() | Species Archaeon Pyrococcus furiosus [TaxId:2261] [64036] (1 PDB entry) |
![]() | Domain d1iqpc2: 1iqp C:9-232 [62654] Other proteins in same PDB: d1iqpa1, d1iqpb1, d1iqpc1, d1iqpd1, d1iqpe1, d1iqpf1 |
PDB Entry: 1iqp (more details), 2.8 Å
SCOP Domain Sequences for d1iqpc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iqpc2 c.37.1.13 (C:9-232) Replication factor C {Archaeon Pyrococcus furiosus} kvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgkttaalalar elfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldeadaltqdaqq alrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlryiaenegle lteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvas
Timeline for d1iqpc2: