Lineage for d1iqpc2 (1iqp C:9-232)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122576Family c.37.1.13: Extended AAA-ATPase domain [52700] (16 proteins)
  6. 122713Protein Replication factor C [64035] (1 species)
  7. 122714Species Archaeon Pyrococcus furiosus [TaxId:2261] [64036] (1 PDB entry)
  8. 122717Domain d1iqpc2: 1iqp C:9-232 [62654]
    Other proteins in same PDB: d1iqpa1, d1iqpb1, d1iqpc1, d1iqpd1, d1iqpe1, d1iqpf1

Details for d1iqpc2

PDB Entry: 1iqp (more details), 2.8 Å

PDB Description: Crystal Structure of the Clamp Loader Small Subunit from Pyrococcus furiosus

SCOP Domain Sequences for d1iqpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqpc2 c.37.1.13 (C:9-232) Replication factor C {Archaeon Pyrococcus furiosus}
kvlekpwvekyrpqrlddivgqehivkrlkhyvktgsmphllfagppgvgkttaalalar
elfgenwrhnflelnasderginvirekvkefartkpiggasfkiifldeadaltqdaqq
alrrtmemfssnvrfilscnysskiiepiqsrcaifrfrplrdediakrlryiaenegle
lteeglqailyiaegdmrrainilqaaaaldkkitdenvfmvas

SCOP Domain Coordinates for d1iqpc2:

Click to download the PDB-style file with coordinates for d1iqpc2.
(The format of our PDB-style files is described here.)

Timeline for d1iqpc2: