![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (1 family) ![]() |
![]() | Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (1 protein) |
![]() | Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species) |
![]() | Species Archaeon Pyrococcus furiosus [TaxId:2261] [64099] (2 PDB entries) |
![]() | Domain d1ioid_: 1ioi D: [62632] mutant |
PDB Entry: 1ioi (more details), 2.7 Å
SCOP Domain Sequences for d1ioid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ioid_ c.56.4.1 (D:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Archaeon Pyrococcus furiosus [TaxId: 2261]} mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk gqvppsmsyemeleavkvaievaleell
Timeline for d1ioid_: