Lineage for d1ioid_ (1ioi D:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 837609Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 838011Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (1 family) (S)
  5. 838012Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (1 protein)
  6. 838013Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species)
  7. 838014Species Archaeon Pyrococcus furiosus [TaxId:2261] [64099] (2 PDB entries)
  8. 838022Domain d1ioid_: 1ioi D: [62632]
    mutant

Details for d1ioid_

PDB Entry: 1ioi (more details), 2.7 Å

PDB Description: x-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, pyrococcus furiosus, and its cys-free mutant
PDB Compounds: (D:) pyrrolidone carboxyl peptidase

SCOP Domain Sequences for d1ioid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ioid_ c.56.4.1 (D:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Archaeon Pyrococcus furiosus [TaxId: 2261]}
mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
gqvppsmsyemeleavkvaievaleell

SCOP Domain Coordinates for d1ioid_:

Click to download the PDB-style file with coordinates for d1ioid_.
(The format of our PDB-style files is described here.)

Timeline for d1ioid_: