SCOPe 2.03: Domain d1iofd_: 1iof D:

Lineage for d1iofd_ (1iof D:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families)

5. Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins)
   automatically mapped to Pfam PF01470

6. Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species)

7. Species Pyrococcus furiosus [TaxId:2261] [64099] (7 PDB entries)

8. Domain d1iofd_: 1iof D: [62628]
   mutant

Details for d1iofd_

PDB Entry: 1iof, 2.2 Å

PDB Description: x-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, pyrococcus furiosus, and its cys-free mutant

PDB Compounds: (D:) pyrrolidone carboxyl peptidase

SCOPe Domain Sequences for d1iofd_:

Sequence; same for both SEQRES and ATOM records:

>d1iofd_ c.56.4.1 (D:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Pyrococcus furiosus [TaxId: 2261]}
mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
mkklhergipayisnsaglylcnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
gqvppsmcyemeleavkvaievaleell

Timeline for d1iofd_:

• d1iofd_ first appeared in SCOP 1.57
  
• d1iofd_ appears in SCOPe 2.02
  
• d1iofd_ appears in SCOPe 2.04
  
• d1iofd_ appears in the current release, SCOPe 2.08