Lineage for d1ijta_ (1ijt A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401197Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2401198Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2401472Protein Fibroblast growth factor 4 (FGF4) [63779] (1 species)
  7. 2401473Species Human (Homo sapiens) [TaxId:9606] [63780] (1 PDB entry)
  8. 2401474Domain d1ijta_: 1ijt A: [62510]
    complexed with so4

Details for d1ijta_

PDB Entry: 1ijt (more details), 1.8 Å

PDB Description: crystal structure of fibroblast growth factor 4 (fgf4)
PDB Compounds: (A:) fibroblast growth factor 4

SCOPe Domain Sequences for d1ijta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijta_ b.42.1.1 (A:) Fibroblast growth factor 4 (FGF4) {Human (Homo sapiens) [TaxId: 9606]}
gikrlrrlycnvgigfhlqalpdgriggahadtrdsllelspvergvvsifgvasrffva
msskgklygspfftdectfkeillpnnynayesykypgmfialgkngktkkgnrvsptmk
vthflprl

SCOPe Domain Coordinates for d1ijta_:

Click to download the PDB-style file with coordinates for d1ijta_.
(The format of our PDB-style files is described here.)

Timeline for d1ijta_: