SCOP 1.75: Domain d1ifqa_: 1ifq A:

Lineage for d1ifqa_ (1ifq A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.4: SNARE-like [64356] (4 families)
   beta(2)-alpha-beta(3)-alpha(2)

5. Family d.110.4.1: Synatpobrevin N-terminal domain [64357] (2 proteins)

6. Protein Sec22b [64358] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [64359] (1 PDB entry)

8. Domain d1ifqa_: 1ifq A: [62350]

Details for d1ifqa_

PDB Entry: 1ifq, 2.4 Å

PDB Description: Sec22b N-terminal domain

PDB Compounds: (A:) vesicle trafficking protein Sec22b

SCOP Domain Sequences for d1ifqa_:

Sequence; same for both SEQRES and ATOM records:

>d1ifqa_ d.110.4.1 (A:) Sec22b {Mouse (Mus musculus) [TaxId: 10090]}
svlltmiarvadglplaasmqedeqsgrdlqqyqsqakqlfrklneqsptrctleagamt
fhyiieqgvcylvlceaafpkklafayledlhsefdeqhgkkvptvsrpysfiefdtfiq
ktkklyi

Timeline for d1ifqa_:

• d1ifqa_ first appeared in SCOP 1.57
  
• d1ifqa_ appears in SCOP 1.73
  
• d1ifqa_ appears in SCOPe 2.01
  
• d1ifqa_ appears in the current release, SCOPe 2.08, called d1ifqa1