SCOPe 2.08: Domain d1ifqa1: 1ifq A:2-127

Lineage for d1ifqa1 (1ifq A:2-127)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.4: SNARE-like [64356] (5 families)
   beta(2)-alpha-beta(3)-alpha(2)

5. Family d.110.4.1: Synatpobrevin N-terminal domain [64357] (3 proteins)

6. Protein Sec22b [64358] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [64359] (1 PDB entry)

8. Domain d1ifqa1: 1ifq A:2-127 [62350]
   Other proteins in same PDB: d1ifqa2, d1ifqb2
   complexed with gol

Details for d1ifqa1

PDB Entry: 1ifq, 2.4 Å

PDB Description: Sec22b N-terminal domain

PDB Compounds: (A:) vesicle trafficking protein Sec22b

SCOPe Domain Sequences for d1ifqa1:

Sequence; same for both SEQRES and ATOM records:

>d1ifqa1 d.110.4.1 (A:2-127) Sec22b {Mouse (Mus musculus) [TaxId: 10090]}
vlltmiarvadglplaasmqedeqsgrdlqqyqsqakqlfrklneqsptrctleagamtf
hyiieqgvcylvlceaafpkklafayledlhsefdeqhgkkvptvsrpysfiefdtfiqk
tkklyi

Timeline for d1ifqa1:

• d1ifqa1 first appeared in SCOP 1.57, called d1ifqa_
  
• d1ifqa1 appears in SCOPe 2.07