Lineage for d1ie3b2 (1ie3 B:146-312)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680348Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1680540Protein Malate dehydrogenase [56329] (12 species)
  7. 1680575Species Escherichia coli [TaxId:562] [56333] (4 PDB entries)
  8. 1680583Domain d1ie3b2: 1ie3 B:146-312 [62307]
    Other proteins in same PDB: d1ie3a1, d1ie3b1, d1ie3c1, d1ie3d1
    complexed with nad, pyr

Details for d1ie3b2

PDB Entry: 1ie3 (more details), 2.5 Å

PDB Description: crystal structure of r153c e. coli malate dehydrogenase
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d1ie3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ie3b2 d.162.1.1 (B:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]}
vttldiicsntfvaelkgkqpgevevpvigghsgvtilpllsqvpgvsfteqevadltkr
iqnagtevveakagggsatlsmgqaaarfglslvralqgeqgvvecayvegdgqyarffs
qplllgkngveerksigtlsafeqnalegmldtlkkdialgqefvnk

SCOPe Domain Coordinates for d1ie3b2:

Click to download the PDB-style file with coordinates for d1ie3b2.
(The format of our PDB-style files is described here.)

Timeline for d1ie3b2: