Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Fab HyHEL-10 (mouse), kappa L chain [48788] (5 PDB entries) |
Domain d1ic5l_: 1ic5 L: [62255] Other proteins in same PDB: d1ic5y_ |
PDB Entry: 1ic5 (more details), 2.3 Å
SCOP Domain Sequences for d1ic5l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ic5l_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fab HyHEL-10 (mouse), kappa L chain} divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtkleik
Timeline for d1ic5l_: