Lineage for d1iblp_ (1ibl P:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3042558Protein 70S ribosome functional complex [58121] (4 species)
  7. 3043115Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 3043134Domain d1iblp_: 1ibl P: [62200]
    protein/RNA complex; complexed with mg, par, zn

Details for d1iblp_

PDB Entry: 1ibl (more details), 3.11 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger rna fragment and cognate transfer rna anticodon stem-loop bound at the a site and with the antibiotic paromomycin
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d1iblp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iblp_ i.1.1.1 (P:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOPe Domain Coordinates for d1iblp_:

Click to download the PDB-style file with coordinates for d1iblp_.
(The format of our PDB-style files is described here.)

Timeline for d1iblp_: