Lineage for d1ibkf_ (1ibk F:)

  1. Root: SCOPe 2.07
  2. 2647132Class i: Low resolution protein structures [58117] (25 folds)
  3. 2647133Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2647134Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2647135Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2647136Protein 70S ribosome functional complex [58121] (4 species)
  7. 2647693Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 2647730Domain d1ibkf_: 1ibk F: [62169]
    complexed with mg, par, zn

Details for d1ibkf_

PDB Entry: 1ibk (more details), 3.31 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d1ibkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibkf_ i.1.1.1 (F:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d1ibkf_:

Click to download the PDB-style file with coordinates for d1ibkf_.
(The format of our PDB-style files is described here.)

Timeline for d1ibkf_: