SCOP 1.61: Domain d1iaqc_: 1iaq C:

Lineage for d1iaqc_ (1iaq C:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families)

5. Family c.37.1.8: G proteins [52592] (26 proteins)

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (36 PDB entries)

8. Domain d1iaqc_: 1iaq C: [62122]

Details for d1iaqc_

PDB Entry: 1iaq, 2.9 Å

PDB Description: c-h-ras p21 protein mutant with thr 35 replaced by ser (t35s) complexed with guanosine-5'-[b,g-imido] triphosphate

SCOP Domain Sequences for d1iaqc_:

Sequence, based on SEQRES records:

>d1iaqc_ c.37.1.8 (C:) cH-p21 Ras protein {Human (Homo sapiens)}
mteyklvvvgaggvgksaltiqliqnhfvdeydpsiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Sequence, based on observed residues (ATOM records):

>d1iaqc_ c.37.1.8 (C:) cH-p21 Ras protein {Human (Homo sapiens)}
mteyklvvvgaggvgksaltiqliqnhfvdedsyrkqvvidgetclldildtagqeeymr
tgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesrqaqdl
arsygipyietsaktrqgvedafytlvreirqh

Timeline for d1iaqc_:

• d1iaqc_ first appeared in SCOP 1.57
  
• d1iaqc_ appears in SCOP 1.59
  
• d1iaqc_ appears in SCOP 1.63
  
• d1iaqc_ appears in the current release, SCOPe 2.08