Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins) |
Protein Immunoreceptor CTLA-4 (CD152), N-terminal fragment [48939] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48940] (3 PDB entries) |
Domain d1i85d_: 1i85 D: [61949] Other proteins in same PDB: d1i85a_, d1i85b_ b7-2 complex |
PDB Entry: 1i85 (more details), 3.2 Å
SCOP Domain Sequences for d1i85d_:
Sequence, based on SEQRES records: (download)
>d1i85d_ b.1.1.1 (D:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens)} mhvaqpavvlassrgiasfvceyaspgkatevrvtvlrqadsqvtevcaatymmgneltf lddsictgtssgnqvnltiqglramdtglyickvelmypppyylgigngtqiyvidpe
>d1i85d_ b.1.1.1 (D:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens)} mhvaqpavvlassrgiasfvceyaatevrvtvlrqqvtevcaatymmgneltflddsict gtssgnqvnltiqglramdtglyickvelmypppyylgigngtqiyvidpe
Timeline for d1i85d_: