SCOPe 2.03: Domain d1i85b_: 1i85 B:

Lineage for d1i85b_ (1i85 B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD86 (b7-2), N-terminal domain [63635] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63636] (2 PDB entries)

8. Domain d1i85b_: 1i85 B: [61947]
   Other proteins in same PDB: d1i85c_, d1i85d_
   complexed to ctla-4

Details for d1i85b_

PDB Entry: 1i85, 3.2 Å

PDB Description: crystal structure of the ctla-4/b7-2 complex

PDB Compounds: (B:) t lymphocyte activation antigen cd86

SCOPe Domain Sequences for d1i85b_:

Sequence; same for both SEQRES and ATOM records:

>d1i85b_ b.1.1.1 (B:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymgr
tsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla

Timeline for d1i85b_:

• d1i85b_ first appeared in SCOP 1.57
  
• d1i85b_ appears in SCOPe 2.02
  
• d1i85b_ appears in SCOPe 2.04
  
• d1i85b_ appears in the current release, SCOPe 2.08