Lineage for d1i6hf_ (1i6h F:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1284114Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 1284115Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 1284155Family a.143.1.2: RPB6 [55294] (1 protein)
  6. 1284156Protein RPB6 [55295] (3 species)
    essential subunit of RNA polymerases I, II and III
  7. 1284157Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (30 PDB entries)
    Uniprot P20435; part of multichain biological unit
  8. 1284169Domain d1i6hf_: 1i6h F: [61837]
    Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hk_, d1i6hl_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d1i6hf_

PDB Entry: 1i6h (more details), 3.3 Å

PDB Description: rna polymerase ii elongation complex
PDB Compounds: (F:) DNA-directed RNA polymerase II 23kd polypeptide

SCOPe Domain Sequences for d1i6hf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6hf_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOPe Domain Coordinates for d1i6hf_:

Click to download the PDB-style file with coordinates for d1i6hf_.
(The format of our PDB-style files is described here.)

Timeline for d1i6hf_: