Class b: All beta proteins [48724] (110 folds) |
Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily) |
Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family) |
Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins) |
Protein Archaeal homoheptameric Sm protein [63758] (3 species) |
Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [63761] (2 PDB entries) |
Domain d1i5lf_: 1i5l F: [61796] |
PDB Entry: 1i5l (more details), 2.75 Å
SCOP Domain Sequences for d1i5lf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i5lf_ b.38.1.1 (F:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus} prpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvvi rgdtvvfvspap
Timeline for d1i5lf_: