Lineage for d1i50e2 (1i50 E:144-215)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657440Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 1657441Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
    automatically mapped to Pfam PF01191
  5. 1657442Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 1657443Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species)
  7. 1657444Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (26 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 1657447Domain d1i50e2: 1i50 E:144-215 [61759]
    Other proteins in same PDB: d1i50a_, d1i50b_, d1i50c1, d1i50c2, d1i50e1, d1i50f_, d1i50h_, d1i50i1, d1i50i2, d1i50j_, d1i50k_, d1i50l_
    protein/RNA complex; complexed with mn, zn

Details for d1i50e2

PDB Entry: 1i50 (more details), 2.8 Å

PDB Description: rna polymerase ii crystal form ii at 2.8 a resolution
PDB Compounds: (E:) DNA-directed RNA polymerase II 27kd polypeptide

SCOPe Domain Sequences for d1i50e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i50e2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d1i50e2:

Click to download the PDB-style file with coordinates for d1i50e2.
(The format of our PDB-style files is described here.)

Timeline for d1i50e2: