Lineage for d1i50e1 (1i50 E:1-143)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245698Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 245905Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 245906Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (1 protein)
  6. 245907Protein Eukaryotic RPB5 N-terminal domain [53038] (1 species)
  7. 245908Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (5 PDB entries)
  8. 245910Domain d1i50e1: 1i50 E:1-143 [61758]
    Other proteins in same PDB: d1i50a_, d1i50b_, d1i50c1, d1i50c2, d1i50e2, d1i50f_, d1i50h_, d1i50i1, d1i50i2, d1i50j_, d1i50k_, d1i50l_
    complexed with mn, zn

Details for d1i50e1

PDB Entry: 1i50 (more details), 2.8 Å

PDB Description: rna polymerase ii crystal form ii at 2.8 a resolution

SCOP Domain Sequences for d1i50e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i50e1 c.52.3.1 (E:1-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
mklvpsippatietfneaalvvn

SCOP Domain Coordinates for d1i50e1:

Click to download the PDB-style file with coordinates for d1i50e1.
(The format of our PDB-style files is described here.)

Timeline for d1i50e1: