Lineage for d1i4kd_ (1i4k D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1539176Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1539177Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1539178Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1539179Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 1539180Species Archaeoglobus fulgidus, AF-Sm1 [TaxId:2234] [63761] (2 PDB entries)
  8. 1539186Domain d1i4kd_: 1i4k D: [61695]
    complexed with cit

Details for d1i4kd_

PDB Entry: 1i4k (more details), 2.5 Å

PDB Description: crystal structure of an sm-like protein (af-sm1) from archaeoglobus fulgidus at 2.5a resolution
PDB Compounds: (D:) putative snrnp sm-like protein

SCOPe Domain Sequences for d1i4kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4kd_ b.38.1.1 (D:) Archaeal homoheptameric Sm protein {Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]}
pprpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvv
irgdtvvfvspa

SCOPe Domain Coordinates for d1i4kd_:

Click to download the PDB-style file with coordinates for d1i4kd_.
(The format of our PDB-style files is described here.)

Timeline for d1i4kd_: