Lineage for d1i3qf_ (1i3q F:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 414133Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 414134Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
  5. 414148Family d.78.1.2: RPB6 [55294] (1 protein)
  6. 414149Protein RPB6 [55295] (2 species)
    essential subunit of RNA polymerases I, II and III
  7. 414150Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (4 PDB entries)
  8. 414153Domain d1i3qf_: 1i3q F: [61613]
    Other proteins in same PDB: d1i3qa_, d1i3qb_, d1i3qc1, d1i3qc2, d1i3qe1, d1i3qe2, d1i3qh_, d1i3qi1, d1i3qi2, d1i3qj_, d1i3qk_, d1i3ql_
    complexed with mg, zn

Details for d1i3qf_

PDB Entry: 1i3q (more details), 3.1 Å

PDB Description: rna polymerase ii crystal form i at 3.1 a resolution

SCOP Domain Sequences for d1i3qf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i3qf_ d.78.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae)}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

SCOP Domain Coordinates for d1i3qf_:

Click to download the PDB-style file with coordinates for d1i3qf_.
(The format of our PDB-style files is described here.)

Timeline for d1i3qf_: