Lineage for d1hzhk2 (1hzh K:114-235)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747669Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2747676Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2747858Domain d1hzhk2: 1hzh K:114-235 [61442]
    Other proteins in same PDB: d1hzhh1, d1hzhh3, d1hzhh4, d1hzhk1, d1hzhk3, d1hzhk4, d1hzhl1, d1hzhl2, d1hzhm1, d1hzhm2
    part of intact IgG B12 antibody

Details for d1hzhk2

PDB Entry: 1hzh (more details), 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design
PDB Compounds: (K:) immunoglobulin heavy chain

SCOPe Domain Sequences for d1hzhk2:

Sequence, based on SEQRES records: (download)

>d1hzhk2 b.1.1.2 (K:114-235) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkaepkscdk

Sequence, based on observed residues (ATOM records): (download)

>d1hzhk2 b.1.1.2 (K:114-235) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapstaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkkaepkscdk

SCOPe Domain Coordinates for d1hzhk2:

Click to download the PDB-style file with coordinates for d1hzhk2.
(The format of our PDB-style files is described here.)

Timeline for d1hzhk2: