SCOP 1.65: Domain d1hz6c_: 1hz6 C:

Lineage for d1hz6c_ (1hz6 C:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)

7. Species Peptostreptococcus magnus [TaxId:1260] [54363] (11 PDB entries)

8. Domain d1hz6c_: 1hz6 C: [61431]
   b1 domain
   mutant

Details for d1hz6c_

PDB Entry: 1hz6, 1.7 Å

PDB Description: crystal structures of the b1 domain of protein l from peptostreptococcus magnus with a tyrosine to tryptophan substitution

SCOP Domain Sequences for d1hz6c_:

Sequence; same for both SEQRES and ATOM records:

>d1hz6c_ d.15.7.1 (C:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus}
eevtikanlifangstqtaefkgtfekatseayayadtlkkdngewtvdvadkgytlnik
fag

Timeline for d1hz6c_:

• d1hz6c_ first appeared in SCOP 1.57
  
• d1hz6c_ appears in SCOP 1.63
  
• d1hz6c_ appears in SCOP 1.67
  
• d1hz6c_ appears in the current release, SCOPe 2.08