![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein T-cell antigen receptor [49125] (7 species) |
![]() | Species Human (Homo sapiens), delta-chain [TaxId:9606] [63662] (2 PDB entries) |
![]() | Domain d1hxmb2: 1hxm B:124-230 [61370] Other proteins in same PDB: d1hxma1, d1hxmb1, d1hxmc1, d1hxmd1, d1hxme1, d1hxmf1, d1hxmg1, d1hxmh1 complexed with so4 |
PDB Entry: 1hxm (more details), 3.12 Å
SCOPe Domain Sequences for d1hxmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hxmb2 b.1.1.2 (B:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} kqldadvspkptiflpsiaetklqkagtylcllekffpdvikihweekksntilgsqegn tmktndtymkfswltvpeksldkehrcivrhennkngvdqeiifppi
Timeline for d1hxmb2: