SCOP 1.65: Domain d1hr9h2: 1hr9 H:246-462

Lineage for d1hr9h2 (1hr9 H:246-462)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (4 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Mitochondrial processing peptidase (MPP) beta chain [64300] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64301] (4 PDB entries)

8. Domain d1hr9h2: 1hr9 H:246-462 [61227]
   Other proteins in same PDB: d1hr9a1, d1hr9a2, d1hr9c1, d1hr9c2, d1hr9e1, d1hr9e2, d1hr9g1, d1hr9g2
   complexed with epe, zn; mutant

Details for d1hr9h2

PDB Entry: 1hr9, 3.01 Å

PDB Description: yeast mitochondrial processing peptidase beta-e73q mutant complexed with malate dehydrogenase signal peptide

SCOP Domain Sequences for d1hr9h2:

Sequence; same for both SEQRES and ATOM records:

>d1hr9h2 d.185.1.1 (H:246-462) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae)}
gplpvfcrgerfikentlptthiaialegvswsapdyfvalatqaivgnwdraigtgtns
psplavaasqngslansymsfstsyadsglwgmyivtdsnehnvrlivneilkewkriks
gkisdaevnrakaqlkaalllsldgstaivedigrqvvttgkrlspeevfeqvdkitkdd
iimwanyrlqnkpvsmvalgntstvpnvsyieeklnq

Timeline for d1hr9h2:

• d1hr9h2 first appeared in SCOP 1.57
  
• d1hr9h2 appears in SCOP 1.63
  
• d1hr9h2 appears in SCOP 1.67
  
• d1hr9h2 appears in the current release, SCOPe 2.08