Lineage for d1hr8b2 (1hr8 B:246-462)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 515367Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 515368Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 515369Family d.185.1.1: MPP-like [63412] (4 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 515504Protein Mitochondrial processing peptidase (MPP) beta chain [64300] (1 species)
  7. 515505Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64301] (4 PDB entries)
  8. 515515Domain d1hr8b2: 1hr8 B:246-462 [61199]
    Other proteins in same PDB: d1hr8a1, d1hr8a2, d1hr8c1, d1hr8c2, d1hr8e1, d1hr8e2, d1hr8g1, d1hr8g2

Details for d1hr8b2

PDB Entry: 1hr8 (more details), 2.7 Å

PDB Description: yeast mitochondrial processing peptidase beta-e73q mutant complexed with cytochrome c oxidase iv signal peptide

SCOP Domain Sequences for d1hr8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr8b2 d.185.1.1 (B:246-462) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae)}
gplpvfcrgerfikentlptthiaialegvswsapdyfvalatqaivgnwdraigtgtns
psplavaasqngslansymsfstsyadsglwgmyivtdsnehnvrlivneilkewkriks
gkisdaevnrakaqlkaalllsldgstaivedigrqvvttgkrlspeevfeqvdkitkdd
iimwanyrlqnkpvsmvalgntstvpnvsyieeklnq

SCOP Domain Coordinates for d1hr8b2:

Click to download the PDB-style file with coordinates for d1hr8b2.
(The format of our PDB-style files is described here.)

Timeline for d1hr8b2: