SCOPe 2.04: Domain d1hm3a1: 1hm3 A:26-335

Lineage for d1hm3a1 (1hm3 A:26-335)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families)
   incomplete toroid

5. Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (5 proteins)

6. Protein Chondroitinase AC [48235] (2 species)
   Chondroitin AC lyase

7. Species Pedobacter heparinus (Flavobacterium heparinum) [TaxId:984] [48236] (5 PDB entries)

8. Domain d1hm3a1: 1hm3 A:26-335 [61086]
   Other proteins in same PDB: d1hm3a2, d1hm3a3
   complexed with ca

Details for d1hm3a1

PDB Entry: 1hm3, 2.1 Å

PDB Description: active site of chondroitinase ac lyase revealed by the structure of enzyme-oligosaccharide complexes and mutagenesis

PDB Compounds: (A:) chondroitinase ac

SCOPe Domain Sequences for d1hm3a1:

Sequence; same for both SEQRES and ATOM records:

>d1hm3a1 a.102.3.2 (A:26-335) Chondroitinase AC {Pedobacter heparinus (Flavobacterium heparinum) [TaxId: 984]}
gtaelimkrvmldlkkplrnmdkvaeknlntlqpdgswkdvpykddamtnwlpnnhllql
etiiqayiekdshyygddkvfdqiskafkywydsdpksrnwwhneiatpqalgemlilmr
ygkkpldealvhkltermkrgepekktganktdialhyfyralltsdeallsfavkelfy
pvqfvhyeeglqydysylqhgpqlqissygavfitgvlklanyvrdtpyalsteklaifs
kyyrdsylkairgsymdfnvegrgvsrpdilnkkaekkrllvakmidlkhteewadaiar
tdstvaagyk

Timeline for d1hm3a1:

• d1hm3a1 first appeared in SCOP 1.57
  
• d1hm3a1 appears in SCOPe 2.03
  
• d1hm3a1 appears in SCOPe 2.05
  
• d1hm3a1 appears in the current release, SCOPe 2.08