| Class b: All beta proteins [48724] (180 folds) |
| Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.3: Cell-division inhibitor MinC, C-terminal domain [63848] (1 family) ![]() superhelix turns are made of three short strands each automatically mapped to Pfam PF03775 |
| Family b.80.3.1: Cell-division inhibitor MinC, C-terminal domain [63849] (1 protein) this is a repeat family; one repeat unit is 1hf2 A:117-135 found in domain |
| Protein Cell-division inhibitor MinC, C-terminal domain [63850] (1 species) |
| Species Thermotoga maritima [TaxId:2336] [63851] (1 PDB entry) |
| Domain d1hf2b1: 1hf2 B:100-207 [60994] Other proteins in same PDB: d1hf2a2, d1hf2b2, d1hf2c2, d1hf2d2 |
PDB Entry: 1hf2 (more details), 2.2 Å
SCOPe Domain Sequences for d1hf2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hf2b1 b.80.3.1 (B:100-207) Cell-division inhibitor MinC, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
tgkvikrnirsgqtvvhsgdvivfgnvnkgaeilaggsvvvfgkaqgniraglneggqav
vaaldlqtsliqiagfithskgeenvpsiahvkgnriviepfdkvsfe
Timeline for d1hf2b1: