Lineage for d1hf2b1 (1hf2 B:100-207)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813492Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813705Superfamily b.80.3: Cell-division inhibitor MinC, C-terminal domain [63848] (1 family) (S)
    superhelix turns are made of three short strands each
    automatically mapped to Pfam PF03775
  5. 2813706Family b.80.3.1: Cell-division inhibitor MinC, C-terminal domain [63849] (1 protein)
    this is a repeat family; one repeat unit is 1hf2 A:117-135 found in domain
  6. 2813707Protein Cell-division inhibitor MinC, C-terminal domain [63850] (1 species)
  7. 2813708Species Thermotoga maritima [TaxId:2336] [63851] (1 PDB entry)
  8. 2813710Domain d1hf2b1: 1hf2 B:100-207 [60994]
    Other proteins in same PDB: d1hf2a2, d1hf2b2, d1hf2c2, d1hf2d2

Details for d1hf2b1

PDB Entry: 1hf2 (more details), 2.2 Å

PDB Description: crystal structure of the bacterial cell-division inhibitor minc from t. maritima
PDB Compounds: (B:) septum site-determining protein minc

SCOPe Domain Sequences for d1hf2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hf2b1 b.80.3.1 (B:100-207) Cell-division inhibitor MinC, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
tgkvikrnirsgqtvvhsgdvivfgnvnkgaeilaggsvvvfgkaqgniraglneggqav
vaaldlqtsliqiagfithskgeenvpsiahvkgnriviepfdkvsfe

SCOPe Domain Coordinates for d1hf2b1:

Click to download the PDB-style file with coordinates for d1hf2b1.
(The format of our PDB-style files is described here.)

Timeline for d1hf2b1: