![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.80.3: Cell-division inhibitor MinC, C-terminal domain [63848] (1 family) ![]() superhelix turns are made of three short strands each automatically mapped to Pfam PF03775 |
![]() | Family b.80.3.1: Cell-division inhibitor MinC, C-terminal domain [63849] (1 protein) this is a repeat family; one repeat unit is 1hf2 A:117-135 found in domain |
![]() | Protein Cell-division inhibitor MinC, C-terminal domain [63850] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [63851] (1 PDB entry) |
![]() | Domain d1hf2a1: 1hf2 A:100-206 [60992] Other proteins in same PDB: d1hf2a2, d1hf2b2, d1hf2c2, d1hf2d2 |
PDB Entry: 1hf2 (more details), 2.2 Å
SCOPe Domain Sequences for d1hf2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hf2a1 b.80.3.1 (A:100-206) Cell-division inhibitor MinC, C-terminal domain {Thermotoga maritima [TaxId: 2336]} tgkvikrnirsgqtvvhsgdvivfgnvnkgaeilaggsvvvfgkaqgniraglneggqav vaaldlqtsliqiagfithskgeenvpsiahvkgnriviepfdkvsf
Timeline for d1hf2a1: