Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (1 family) can be classified as disulphide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) |
Protein Angiogenin [54094] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54095] (18 PDB entries) |
Domain d1hbya_: 1hby A: [60936] complexed with po4 |
PDB Entry: 1hby (more details), 2 Å
SCOP Domain Sequences for d1hbya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hbya_ d.5.1.1 (A:) Angiogenin {Human (Homo sapiens)} ednsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif rrp
Timeline for d1hbya_: