Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.1: Elongation factors [50448] (10 proteins) |
Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species) N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology |
Species Thermus thermophilus [TaxId:274] [50452] (6 PDB entries) |
Domain d1ha3b1: 1ha3 B:213-312 [60872] Other proteins in same PDB: d1ha3a2, d1ha3a3, d1ha3b2, d1ha3b3 complexed with bme, gdp, mau, mg |
PDB Entry: 1ha3 (more details), 2 Å
SCOPe Domain Sequences for d1ha3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ha3b1 b.43.3.1 (B:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp
Timeline for d1ha3b1: