Lineage for d1h9sa1 (1h9s A:123-199)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59750Superfamily b.40.6: MOP-like [50331] (3 families) (S)
  5. 59766Family b.40.6.2: BiMOP, duplicated molybdate-binding domain [50335] (2 proteins)
  6. 59767Protein C-terminal domain of molybdate-dependent transcriptional regulator ModE [63405] (1 species)
  7. 59768Species Escherichia coli [TaxId:562] [50337] (4 PDB entries)
  8. 59773Domain d1h9sa1: 1h9s A:123-199 [60843]

Details for d1h9sa1

PDB Entry: 1h9s (more details), 1.82 Å

PDB Description: molybdate bound complex of dimop domain of mode from e.coli

SCOP Domain Sequences for d1h9sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9sa1 b.40.6.2 (A:123-199) C-terminal domain of molybdate-dependent transcriptional regulator ModE {Escherichia coli}
mqtsarnqwfgtitardhddvqqhvdvlladgktrlkvaitaqsgarlgldegkevlill
kapwvgitqdeavaqna

SCOP Domain Coordinates for d1h9sa1:

Click to download the PDB-style file with coordinates for d1h9sa1.
(The format of our PDB-style files is described here.)

Timeline for d1h9sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h9sa2