Lineage for d1h9oa_ (1h9o A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 332255Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 332256Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 332257Family d.93.1.1: SH2 domain [55551] (25 proteins)
  6. 332403Protein Phosphatidylinositol 3-kinase, p85-alpha subunit [55569] (3 species)
  7. 332412Species Human (Homo sapiens) [TaxId:9606] [55571] (2 PDB entries)
  8. 332413Domain d1h9oa_: 1h9o A: [60837]
    complexed with a tyr751 phosphopeptide from the pdgf receptor

Details for d1h9oa_

PDB Entry: 1h9o (more details), 1.79 Å

PDB Description: phosphatidylinositol 3-kinase, p85-alpha subunit: c-terminal sh2 domain complexed with a tyr751 phosphopeptide from the pdgf receptor, crystal structure at 1.79 a

SCOP Domain Sequences for d1h9oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h9oa_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Human (Homo sapiens)}
gspiphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvi
nktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvya

SCOP Domain Coordinates for d1h9oa_:

Click to download the PDB-style file with coordinates for d1h9oa_.
(The format of our PDB-style files is described here.)

Timeline for d1h9oa_: