Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) |
Superfamily d.93.1: SH2 domain [55550] (1 family) |
Family d.93.1.1: SH2 domain [55551] (20 proteins) |
Protein Phosphatidylinositol 3-kinase, p85-alpha subunit [55569] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [55571] (2 PDB entries) |
Domain d1h9oa_: 1h9o A: [60837] |
PDB Entry: 1h9o (more details), 1.79 Å
SCOP Domain Sequences for d1h9oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h9oa_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Human (Homo sapiens)} gspiphhdektwnvgssnrnkaenllrgkrdgtflvresskqgcyacsvvvdgevkhcvi nktatgygfaepynlysslkelvlhyqhtslvqhndslnvtlaypvya
Timeline for d1h9oa_: