SCOP 1.67: Domain d1h8ua_: 1h8u A:

Lineage for d1h8ua_ (1h8u A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (22 proteins)

6. Protein Eosinophil major basic protein [64457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64458] (1 PDB entry)

8. Domain d1h8ua_: 1h8u A: [60793]

Details for d1h8ua_

PDB Entry: 1h8u, 1.8 Å

PDB Description: crystal structure of the eosinophil major basic protein at 1.8a: an atypical lectin with a paradigm shift in specificity

SCOP Domain Sequences for d1h8ua_:

Sequence; same for both SEQRES and ATOM records:

>d1h8ua_ d.169.1.1 (A:) Eosinophil major basic protein {Human (Homo sapiens)}
ryllvrslqtfsqawftcrrcyrgnlvsihnfninyriqcsvsalnqgqvwiggritgsg
rcrrfqwvdgsrwnfaywaahqpwsrgghcvalctrggywrrahclrrlpficsy

Timeline for d1h8ua_:

• d1h8ua_ first appeared in SCOP 1.57
  
• d1h8ua_ appears in SCOP 1.65
  
• d1h8ua_ appears in SCOP 1.69
  
• d1h8ua_ appears in the current release, SCOPe 2.08