SCOP 1.57: Domain d1h8ob1: 1h8o B:4-112

Lineage for d1h8ob1 (1h8o B:4-112)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Anti-ampicillin scFv, (mouse), kappa L chain [63645] (3 PDB entries)

8. Domain d1h8ob1: 1h8o B:4-112 [60787]

Details for d1h8ob1

PDB Entry: 1h8o, 2.75 Å

PDB Description: three-dimensional structure of anti-ampicillin single chain fv fragment.

SCOP Domain Sequences for d1h8ob1:

Sequence; same for both SEQRES and ATOM records:

>d1h8ob1 b.1.1.1 (B:4-112) Immunoglobulin (variable domains of L and H chains) {Anti-ampicillin scFv, (mouse), kappa L chain}
divltqshkfmstsvgdrvsitckasqdvgtavawyqqkpgqspklliywastrhtgvpd
rftgsgsgtdftltisnvqsedladyfcqqyssypltfgagtklelkrg

Timeline for d1h8ob1:

• d1h8ob1 is new in SCOP 1.57
  
• d1h8ob1 appears in SCOP 1.59
  
• d1h8ob1 appears in the current release, SCOPe 2.08