Lineage for d1h8hd2 (1h8h D:9-81)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1320662Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1320663Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
    automatically mapped to Pfam PF02874
  5. 1320664Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 1320720Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 1320723Species Cow (Bos taurus) [TaxId:9913] [88678] (18 PDB entries)
    Uniprot P00829
  8. 1320778Domain d1h8hd2: 1h8h D:9-81 [60769]
    Other proteins in same PDB: d1h8ha1, d1h8ha2, d1h8ha3, d1h8hb1, d1h8hb2, d1h8hb3, d1h8hc1, d1h8hc2, d1h8hc3, d1h8hd1, d1h8hd3, d1h8he1, d1h8he3, d1h8hf1, d1h8hf3, d1h8hg_
    complexed with adp, atp, gol, mg, po4

Details for d1h8hd2

PDB Entry: 1h8h (more details), 2.9 Å

PDB Description: bovine mitochondrial f1-atpase crystallised in the presence of 5mm amppnp
PDB Compounds: (D:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1h8hd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8hd2 b.49.1.1 (D:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOPe Domain Coordinates for d1h8hd2:

Click to download the PDB-style file with coordinates for d1h8hd2.
(The format of our PDB-style files is described here.)

Timeline for d1h8hd2: