Lineage for d1h8ea2 (1h8e A:19-94)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798608Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2798609Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2798610Protein F1 ATP synthase alpha subunit, domain 1 [88672] (5 species)
  7. 2798629Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries)
    Uniprot P19483
  8. 2798648Domain d1h8ea2: 1h8e A:19-94 [60739]
    Other proteins in same PDB: d1h8ea1, d1h8ea3, d1h8eb1, d1h8eb3, d1h8ec1, d1h8ec3, d1h8ed1, d1h8ed2, d1h8ed3, d1h8ee1, d1h8ee2, d1h8ee3, d1h8ef1, d1h8ef2, d1h8ef3, d1h8eg_, d1h8eh_, d1h8ei_
    complexed with adp, alf, gol, mg, so4

Details for d1h8ea2

PDB Entry: 1h8e (more details), 2 Å

PDB Description: (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)
PDB Compounds: (A:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1h8ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8ea2 b.49.1.1 (A:19-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn
dklikegdivkrtgai

SCOPe Domain Coordinates for d1h8ea2:

Click to download the PDB-style file with coordinates for d1h8ea2.
(The format of our PDB-style files is described here.)

Timeline for d1h8ea2: