![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (23 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.9: alpha-catenin/vinculin [47220] (1 family) ![]() |
![]() | Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins) possible duplication: contains several domains of this fold The listed PDB entries contain different large fragments but not the whole proteins |
![]() | Protein alpha-catenin [47222] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63511] (2 PDB entries) |
![]() | Domain d1h6ga2: 1h6g A:508-631 [60670] |
PDB Entry: 1h6g (more details), 2.2 Å
SCOP Domain Sequences for d1h6ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6ga2 a.24.9.1 (A:508-631) alpha-catenin {Human (Homo sapiens)} iddflavsenhiledvnkcvialqekdvdgldrtagairgraarvihvvtsemdnyepgv ytekvleatkllsntvmprfteqveaavealssdpaqpmdenefidasrlvydgirdirk avlm
Timeline for d1h6ga2: