SCOP 1.57: Domain d1gjwa1: 1gjw A:573-636

Lineage for d1gjwa1 (1gjw A:573-636)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)

4. Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins)

6. Protein Maltosyltransferase [63835] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [63836] (2 PDB entries)

8. Domain d1gjwa1: 1gjw A:573-636 [60582]
   Other proteins in same PDB: d1gjwa2

Details for d1gjwa1

PDB Entry: 1gjw, 2.1 Å

PDB Description: thermotoga maritima maltosyltransferase complex with maltose

SCOP Domain Sequences for d1gjwa1:

Sequence; same for both SEQRES and ATOM records:

>d1gjwa1 b.71.1.1 (A:573-636) Maltosyltransferase {Thermotoga maritima}
gkfenlttkdlvmysyekngqkiviaanvgkepkeitggrvwngkwsdeekvvlkplefa
lvvq

Timeline for d1gjwa1:

• d1gjwa1 is new in SCOP 1.57
  
• d1gjwa1 appears in SCOP 1.59
  
• d1gjwa1 appears in the current release, SCOPe 2.08