Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
Protein 70S ribosome functional complex [58121] (4 species) |
Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries) |
Domain d1giyl_: 1giy L: [60559] |
PDB Entry: 1giy (more details), 5.5 Å
SCOPe Domain Sequences for d1giyl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1giyl_ i.1.1.1 (L:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]} qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki iegtaksmgievv
Timeline for d1giyl_: