| Root: SCOPe 2.08 |
| Class i: Low resolution protein structures [58117] (25 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
| Protein 70S ribosome functional complex [58121] (4 species) |
| Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries) |
| Domain d1gixk_: 1gix K: [60534] |
PDB Entry: 1gix (more details), 5.5 Å
SCOPe Domain Sequences for d1gixk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gixk_ i.1.1.1 (K:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw
Timeline for d1gixk_: